PDB entry 1c9s

View 1c9s on RCSB PDB site
Description: crystal structure of a complex of trp RNA-binding attenuation protein with a 53-base single stranded RNA containing eleven gag triplets separated by au dinucleotides
Class: RNA binding protein/RNA
Keywords: trap, protein-RNA complex, transcription, single stranded RNA, RNA binding protein/RNA complex
Deposited on 1999-08-03, released 1999-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.23
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9sa_
  • Chain 'B':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9sb_
  • Chain 'C':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9sc_
  • Chain 'D':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9sd_
  • Chain 'E':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9se_
  • Chain 'F':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9sf_
  • Chain 'G':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9sg_
  • Chain 'H':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9sh_
  • Chain 'I':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9si_
  • Chain 'J':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9sj_
  • Chain 'K':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9sk_
  • Chain 'L':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9sl_
  • Chain 'M':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9sm_
  • Chain 'N':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9sn_
  • Chain 'O':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9so_
  • Chain 'P':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9sp_
  • Chain 'Q':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9sq_
  • Chain 'R':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9sr_
  • Chain 'S':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9ss_
  • Chain 'T':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9st_
  • Chain 'U':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9su_
  • Chain 'V':
    Compound: trp RNA-binding attenuation protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9sv_
  • Chain 'W':
    Compound: single stranded RNA (55-mer)
    Species: synthetic, synthetic
  • Heterogens: TRP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c9sA (A:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9sA (A:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgviesegk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c9sB (B:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9sB (B:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgvieseg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1c9sC (C:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9sC (C:)
    nsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqt
    rhgvieseg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1c9sD (D:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9sD (D:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgviesegk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1c9sE (E:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9sE (E:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgvieseg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1c9sF (F:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9sF (F:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgviesegk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1c9sG (G:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9sG (G:)
    nsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqt
    rhgviesegk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1c9sH (H:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9sH (H:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgviesegk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1c9sI (I:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9sI (I:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgviesegk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1c9sJ (J:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9sJ (J:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgviese
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1c9sK (K:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9sK (K:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgviesegk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1c9sL (L:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9sL (L:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1c9sM (M:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9sM (M:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgviesegk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1c9sN (N:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9sN (N:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1c9sO (O:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9sO (O:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgviesegk
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1c9sP (P:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9sP (P:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1c9sQ (Q:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9sQ (Q:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1c9sR (R:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9sR (R:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1c9sS (S:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9sS (S:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1c9sT (T:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9sT (T:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1c9sU (U:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9sU (U:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1c9sV (V:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9sV (V:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'W':
    No sequence available.