PDB entry 1c9q

View 1c9q on RCSB PDB site
Description: average nmr solution structure of the bir-2 domain of xiap
Class: apoptosis
Keywords: zinc finger, apoptosis, inhibitor
Deposited on 1999-08-03, released 2000-08-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apoptosis inhibitor iap homolog
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P98170 (0-116)
      • engineered (78)
      • engineered (89)
    Domains in SCOPe 2.08: d1c9qa_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9qA (A:)
    rdhfaldrpsethadyllrtgqvvdisdtiyprnpamyseearlksfqnwpdyahltpre
    lasaglyytgigdqvqcfacggklknwepgdrawsehrrhfpncffvlgrnlnirse