PDB entry 1c9o

View 1c9o on RCSB PDB site
Description: crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp
Deposited on 1999-08-03, released 2000-04-02
The last revision prior to the SCOP 1.55 freeze date was dated 2001-02-14, with a file datestamp of 2001-02-14.
Experiment type: XRAY
Resolution: 1.17 Å
R-factor: 0.125
AEROSPACI score: 0.88 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1c9oa_
  • Chain 'B':
    Domains in SCOP 1.55: d1c9ob_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9oA (A:)
    mqrgkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqevsfeivqgnrgpqa
    anvvkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9oB (B:)
    mqrgkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqevsfeivqgnrgpqa
    anvvkl