PDB entry 1c9n

View 1c9n on RCSB PDB site
Description: bacillus lentus substilisin variant (ser 87) k27r/v104y/n123s/t274a
Class: hydrolase
Keywords: subtiliin, altered flexibility, hydrolase, site-specific variant
Deposited on 1999-08-02, released 1999-10-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine protease
    Species: Bacillus lentus [TaxId:1467]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9na_
  • Heterogens: SO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9nA (A:)
    aqsvpwgisrvqapaahnrgltgsgvrvavldtgisthpdlnirggasfvpgepstqdgn
    ghgthvagtiaalnnsigvlgvapsaelyavkvlgasgsgsyssiaqglewagnngmhva
    slslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr
    asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi
    rnhlkntatslgstnlygsglvnaeaaar