PDB entry 1c9m

View 1c9m on RCSB PDB site
Description: bacillus lentus subtilsin (ser 87) n76d/s103a/v104i
Class: hydrolase
Keywords: serine protease, subtilisin, site-specific variant, altered flexibility, hydrolase
Deposited on 1999-08-02, released 1999-10-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine protease
    Species: Bacillus lentus [TaxId:1467]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1c9ma_
  • Heterogens: SO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c9mA (A:)
aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn
ghgthvagtiaaldnsigvlgvapsaelyavkvlgasgsgaissiaqglewagnngmhva
nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr
asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi
rnhlkntatslgstnlygsglvnaeaatr