PDB entry 1c9l

View 1c9l on RCSB PDB site
Description: peptide-in-groove interactions link target proteins to the b-propeller of clathrin
Class: endocytosis/exocytosis
Keywords: beta-propeller, helical hairpin, endocytosis/exocytosis complex
Deposited on 1999-08-02, released 2000-02-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.221
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: clathrin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1c9la1, d1c9la2
  • Chain 'B':
    Compound: clathrin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1c9lb1, d1c9lb2
  • Chain 'C':
    Compound: b-adaptin 3
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1C9L (0-7)
  • Chain 'D':
    Compound: b-adaptin 3
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1C9L (0-7)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9lA (A:)
    qilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsnpi
    rrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntvalv
    tdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvgamq
    lysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgnqp
    fpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisget
    ifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlag
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9lB (B:)
    qilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsnpi
    rrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntvalv
    tdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvgamq
    lysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgnqp
    fpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisget
    ifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlag
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.