PDB entry 1c9l

View 1c9l on RCSB PDB site
Description: peptide-in-groove interactions link target proteins to the b-propeller of clathrin
Deposited on 1999-08-02, released 2000-02-07
The last revision prior to the SCOP 1.55 freeze date was dated 2000-02-07, with a file datestamp of 2000-02-07.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.221
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9lA (A:)
    qilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsnpi
    rrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntvalv
    tdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvgamq
    lysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgnqp
    fpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisget
    ifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlag
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9lB (B:)
    qilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsnpi
    rrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntvalv
    tdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvgamq
    lysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgnqp
    fpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisget
    ifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlag