PDB entry 1c9k

View 1c9k on RCSB PDB site
Description: the three dimensional structure of adenosylcobinamide kinase/ adenosylcobinamide phosphate gualylyltransferase (cobu) complexed with gmp: evidence for a substrate induced transferase active site
Class: transferase
Keywords: alpha/beta structure rossmann fold p-loop, transferase
Deposited on 1999-08-02, released 1999-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.191
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenosylcobinamide kinase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9ka_
  • Chain 'B':
    Compound: adenosylcobinamide kinase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9kb_
  • Chain 'C':
    Compound: adenosylcobinamide kinase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9kc_
  • Heterogens: PO4, MG, 5GP, POP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c9kA (A:)
    milvtggarsgksrhaealigdapqvlyiatsqilddemaariqhhkdgrpahwrtaecw
    rhldtlitadlapddaillecittmvtnllfalggendpeqwdyaameraiddeiqilia
    acqrcpakvvlvtnevgmgivpenrlarhfrdiagrvnqrlaaaadevwlvvsgigvkik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9kA (A:)
    milvtggarsgksrhaealigdapqvlyiatsqiariqhhkdgrpahwrtaecwrhldtl
    itadlapddaillecittmvtnllfaldpeqwdyaameraiddeiqiliaacqrcpakvv
    lvtnevgmgivpenrlarhfrdiagrvnqrlaaaadevwlvvsgigvkik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9kB (B:)
    milvtggarsgksrhaealigdapqvlyiatsqilddemaariqhhkdgrpahwrtaecw
    rhldtlitadlapddaillecittmvtnllfalggendpeqwdyaameraiddeiqilia
    acqrcpakvvlvtnevgmgivpenrlarhfrdiagrvnqrlaaaadevwlvvsgigvkik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1c9kC (C:)
    milvtggarsgksrhaealigdapqvlyiatsqilddemaariqhhkdgrpahwrtaecw
    rhldtlitadlapddaillecittmvtnllfalggendpeqwdyaameraiddeiqilia
    acqrcpakvvlvtnevgmgivpenrlarhfrdiagrvnqrlaaaadevwlvvsgigvkik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9kC (C:)
    milvtggarsgksrhaealigdapqvlyiatsqilhhkdgrpahwrtarhldtlitadla
    pddaillecittmvtnllfalgdpeqwdyaameraiddeiqiliaacqrcpakvvlvtne
    vgmgivpenrlarhfrdiagrvnqrlaaaadevwlvvsgigvkik