PDB entry 1c9i

View 1c9i on RCSB PDB site
Description: peptide-in-groove interactions link target proteins to the b-propeller of clathrin
Class: endocytosis/exocytosis
Keywords: beta-propeller, helical hairpin, endocytosis-exocytosis complex
Deposited on 1999-08-02, released 2000-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: clathrin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9ia1, d1c9ia2
  • Chain 'B':
    Compound: clathrin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9ib1, d1c9ib2
  • Chain 'C':
    Compound: b-adaptin 3
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1C9I (0-8)
  • Chain 'D':
    Compound: b-adaptin 3
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1C9I

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c9iA (A:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9iA (A:)
    qilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsnpi
    rrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntvalv
    tdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvgamq
    lysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgnqp
    fpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisget
    ifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c9iB (B:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9iB (B:)
    ilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsnpir
    rpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntvalvt
    dnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvgamql
    ysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgnqpf
    pkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisgeti
    fvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnla
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.