PDB entry 1c9h

View 1c9h on RCSB PDB site
Description: crystal structure of fkbp12.6 in complex with rapamycin
Deposited on 1999-08-02, released 2000-08-03
The last revision prior to the SCOP 1.63 freeze date was dated 2000-08-03, with a file datestamp of 2000-08-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.63: d1c9ha_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c9hA (A:)
  gveietispgdgrtfpkkgqtcvvhytgmlqngkkfdssrdrnkpfkfrigkqevikgfe
  egaaqmslgqrakltctpdvaygatghpgvippnatlifdvellnle