PDB entry 1c9h

View 1c9h on RCSB PDB site
Description: crystal structure of fkbp12.6 in complex with rapamycin
Class: immune system
Keywords: fkbp12, rapamycin, complex, ryanodine receptor, immune system
Deposited on 1999-08-02, released 2000-08-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fkbp12.6
    Species: Homo sapiens [TaxId:9606]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1c9ha_
  • Heterogens: RAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c9hA (A:)
gveietispgdgrtfpkkgqtcvvhytgmlqngkkfdssrdrnkpfkfrigkqevikgfe
egaaqmslgqrakltctpdvaygatghpgvippnatlifdvellnle