PDB entry 1c9f

View 1c9f on RCSB PDB site
Description: nmr structure of the cad domain of caspase-activated dnase
Deposited on 1999-08-02, released 2000-02-16
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-26, with a file datestamp of 2000-06-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1c9fa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c9fA (A:)
  mcavlrqpkcvklralhsackfgvaarscqellrkgcvrfqlpmpgsrlclyedgtevtd
  dcfpglpndaelllltagetwhgyvsd