PDB entry 1c9e

View 1c9e on RCSB PDB site
Description: structure of ferrochelatase with copper(II) n-methylmesoporphyrin complex bound at the active site
Class: lyase
Keywords: bacillus subtilis, chelatase, porphyrin metallation, n-methylmesoporphyrin, heme synthesis, lyase
Deposited on 1999-08-02, released 2000-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.184
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protoheme ferrolyase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9ea_
  • Heterogens: MG, MP1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9eA (A:)
    kmgllvmaygtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqiteqqa
    hnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstfsvqs
    ynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamlivsahs
    lpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltrdlfe
    qkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidalatvv
    lkklgr