PDB entry 1c9b

View 1c9b on RCSB PDB site
Description: crystal structure of a human tbp core domain-human tfiib core domain complex bound to an extended, modified adenoviral major late promoter (admlp)
Deposited on 1999-08-01, released 2000-01-10
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-10, with a file datestamp of 2000-01-09.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.229
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9bA (A:)
    sdrammnafkeittmadrinlprnivdrtnnlfkqvyeqkslkgrandaiasaclyiacr
    qegvprtfkeicavsriskkeigrcfklilkaletsvdlittgdfmsrfcsnlclpkqvq
    maathiarkaveldlvpgrspisvaaaaiymasqasaekrtqkeigdiagvadvtirqsy
    rliyprapdlfptdfkfdtpvdklpql
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9bB (B:)
    gsgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssg
    kmvctgakseeqsrlaarkyarvvqklgfpakfldfkiqnmvgscdvkfpirleglvlth
    qqfssyepelfpgliyrmikprivllifvsgkvvltgakvraeiyeafeniypilkgfrk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9bE (E:)
    sdrammnafkeittmadrinlprnivdrtnnlfkqvyeqkslkgrandaiasaclyiacr
    qegvprtfkeicavsriskkeigrcfklilkaletsvdlittgdfmsrfcsnlclpkqvq
    maathiarkaveldlvpgrspisvaaaaiymasqasaekrtqkeigdiagvadvtirqsy
    rliyprapdlfptdfkfdtpvdklpql
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9bF (F:)
    gsgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssg
    kmvctgakseeqsrlaarkyarvvqklgfpakfldfkiqnmvgscdvkfpirleglvlth
    qqfssyepelfpgliyrmikprivllifvsgkvvltgakvraeiyeafeniypilkgfrk
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9bI (I:)
    sdrammnafkeittmadrinlprnivdrtnnlfkqvyeqkslkgrandaiasaclyiacr
    qegvprtfkeicavsriskkeigrcfklilkaletsvdlittgdfmsrfcsnlclpkqvq
    maathiarkaveldlvpgrspisvaaaaiymasqasaekrtqkeigdiagvadvtirqsy
    rliyprapdlfptdfkfdtpvdklpql
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9bJ (J:)
    gsgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssg
    kmvctgakseeqsrlaarkyarvvqklgfpakfldfkiqnmvgscdvkfpirleglvlth
    qqfssyepelfpgliyrmikprivllifvsgkvvltgakvraeiyeafeniypilkgfrk
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9bM (M:)
    sdrammnafkeittmadrinlprnivdrtnnlfkqvyeqkslkgrandaiasaclyiacr
    qegvprtfkeicavsriskkeigrcfklilkaletsvdlittgdfmsrfcsnlclpkqvq
    maathiarkaveldlvpgrspisvaaaaiymasqasaekrtqkeigdiagvadvtirqsy
    rliyprapdlfptdfkfdtpvdklpql
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9bN (N:)
    gsgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssg
    kmvctgakseeqsrlaarkyarvvqklgfpakfldfkiqnmvgscdvkfpirleglvlth
    qqfssyepelfpgliyrmikprivllifvsgkvvltgakvraeiyeafeniypilkgfrk
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9bQ (Q:)
    sdrammnafkeittmadrinlprnivdrtnnlfkqvyeqkslkgrandaiasaclyiacr
    qegvprtfkeicavsriskkeigrcfklilkaletsvdlittgdfmsrfcsnlclpkqvq
    maathiarkaveldlvpgrspisvaaaaiymasqasaekrtqkeigdiagvadvtirqsy
    rliyprapdlfptdfkfdtpvdklpql
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9bR (R:)
    gsgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssg
    kmvctgakseeqsrlaarkyarvvqklgfpakfldfkiqnmvgscdvkfpirleglvlth
    qqfssyepelfpgliyrmikprivllifvsgkvvltgakvraeiyeafeniypilkgfrk