PDB entry 1c99

View 1c99 on RCSB PDB site
Description: asp61 deprotonated form of subunit c of the f1fo ATP synthase of escherichia coli
Class: proton transport, hydrolase
Keywords: proteolipid f1fo, ATP synthase, proton translocation, proton transport, hydrolase
Deposited on 1999-04-30, released 1999-11-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proteolipid f1fo of ATP synthase
    Species: Escherichia coli [TaxId:562]
    Gene: UNCE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1c99a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c99A (A:)
    menlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglv
    daipmiavglglyvmfava