PDB entry 1c96

View 1c96 on RCSB PDB site
Description: s642a:citrate complex of aconitase
Deposited on 1999-07-31, released 1999-08-12
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-07, with a file datestamp of 2000-01-06.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.225
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c96A (A:)
    rakvamshfepheyirydlleknidivrkrlnrpltlsekivyghlddpanqeiergkty
    lrlrpdrvamqdataqmamlqfissglpkvavpstihcdhlieaqlggekdlrrakdinq
    evynflatagakygvgfwrpgsgiihqiilenyaypgvlligtdshtpnggglggicigv
    ggadavdvmagipwelkcpkvigvkltgslsgwtspkdvilkvagiltvkggtgaiveyh
    gpgvdsisctgmaticnmgaeigattsvfpynhrmkkylsktgradianladefkdhlvp
    dpgchydqvieinlselkphingpftpdlahpvaevgsvaekegwpldirvgligsctns
    syedmgrsaavakqalahglkcksqftitpgseqiratierdgyaqvlrdvggivlanac
    gpcigqwdrkdikkgekntivtsynrnftgrndanpethafvtspeivtalaiagtlkfn
    petdfltgkdgkkfkleapdadelpraefdpgqdtyqhppkdssgqrvavsptsqrlqll
    epfdkwdgkdledlqilikvkgkcttdhisaagpwlkfrghldnisnnlligainienrk
    ansvrnavtqefgpvpdtaryykqhgirwvvigdenygegasrehsaleprhlggraiit
    ksfarihetnlkkqgllpltfadpadynkihpvdkltiqglkdfapgkplkciikhpngt
    qetillnhtfnetqiewfragsalnrmkelqqk