PDB entry 1c93

View 1c93 on RCSB PDB site
Description: endo-beta-n-acetylglucosaminidase h, d130n/e132q double mutant
Deposited on 1999-07-30, released 1999-11-26
The last revision prior to the SCOP 1.67 freeze date was dated 2003-04-25, with a file datestamp of 2003-04-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1c93a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c93A (A:)
    kqgptsvayvevnnnsmlnvgkytladgggnafdvavifaaninydtgtktaylhfnenv
    qrvldnavtqirplqqqgikvllsvlgnhqgagfanfpsqqaasafakqlsdavakygld
    gvdfndqyaeygnngtaqpndssfvhlvtalranmpdkiislynigpaasrlsyggvdvs
    dkfdyawnpyygtwqvpgialpkaqlspaaveigrtsrstvadlarrtvdegygvyltyn
    ldggdrtadvsaftrelygseavrt