PDB entry 1c90

View 1c90 on RCSB PDB site
Description:
Deposited on 1999-07-30, released 1999-11-26
The last revision prior to the SCOP 1.55 freeze date was dated 1999-11-26, with a file datestamp of 1999-11-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1c90a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1c90b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c90A (A:)
    kqgptsvayvevnnnsmlnvgkytladgggnafdvavifaaninydtgtktaylhfnenv
    qrvldnavtqirplqqqgikvllsvlgnhqgagfanfpsqqaasafakqlsdavakygld
    gvdfddqyaeygnngtaqpndssfvhlvtalranmpdkiislynigpaasrlsyggvdvs
    dkfdyawnpyygtwqvpgialpkaqlspaaveigrtsrstvadlarrtvdegygvyltyn
    ldggdrtadvsaftrelygseavrt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c90B (B:)
    kqgptsvayvevnnnsmlnvgkytladgggnafdvavifaaninydtgtktaylhfnenv
    qrvldnavtqirplqqqgikvllsvlgnhqgagfanfpsqqaasafakqlsdavakygld
    gvdfddqyaeygnngtaqpndssfvhlvtalranmpdkiislynigpaasrlsyggvdvs
    dkfdyawnpyygtwqvpgialpkaqlspaaveigrtsrstvadlarrtvdegygvyltyn
    ldggdrtadvsaftrelygseavrt