PDB entry 1c8z

View 1c8z on RCSB PDB site
Description: c-terminal domain of mouse brain tubby protein
Class: signaling protein
Keywords: tubby filled-barrel, beta-barrel, filled-beta-roll, 12-stranded-beta-barrel, helix-filled-barrel, obesity blindness, deafness, signaling protein
Deposited on 1999-07-30, released 1999-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.21
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tubby protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50586 (0-264)
      • conflict (0-1)
      • conflict (39)
    Domains in SCOPe 2.07: d1c8za_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c8zA (A:)
    gsvdievqdleefalrpapqgitikcritrdkkgmdrgmfptyflhldredgkkvfllag
    rkrkksktsnylisvdptdlsrggdsyigklrsnlmgtkftvydngvnpqkassstlesg
    tlrqelaavcyetnvlgfkgprkmsvivpgmnmvhervcirprnehetllarwqnkntes
    iielqnktpvwnddtqsyvlnfhgrvtqasvknfqiihgndpdyivmqfgrvaedvftmd
    ynyplcalqafaialssfdsklace