PDB entry 1c8y

View 1c8y on RCSB PDB site
Description: Endo-Beta-N-Acetylglucosaminidase H, D130A Mutant
Class: hydrolase
Keywords: (beta/alpha)8-barrel, hydrolase
Deposited on 1999-07-30, released 1999-11-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-beta-n-acetylglucosaminidase h
    Species: Streptomyces plicatus [TaxId:1922]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04067 (0-264)
      • engineered (124)
    Domains in SCOPe 2.05: d1c8ya_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c8yA (A:)
    kqgptsvayvevnnnsmlnvgkytladgggnafdvavifaaninydtgtktaylhfnenv
    qrvldnavtqirplqqqgikvllsvlgnhqgagfanfpsqqaasafakqlsdavakygld
    gvdfadeyaeygnngtaqpndssfvhlvtalranmpdkiislynigpaasrlsyggvdvs
    dkfdyawnpyygtwqvpgialpkaqlspaaveigrtsrstvadlarrtvdegygvyltyn
    ldggdrtadvsaftrelygseavrt