PDB entry 1c8w

View 1c8w on RCSB PDB site
Description: thr45gly variant of ribonuclease a
Class: hydrolase
Keywords: anti-parallel beta sheet, RNAse a, hydrolase
Deposited on 1999-07-30, released 2002-05-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: PROTEIN (Ribonuclease A)
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-123)
    • engineered mutation (44)
  Domains in SCOPe 2.08: d1c8wa_
• Heterogens: ACT, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c8wA (A:)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvngfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
  dasv