PDB entry 1c8w

View 1c8w on RCSB PDB site
Description: thr45gly variant of ribonuclease a
Class: hydrolase
Keywords: anti-parallel beta sheet, RNAse a, hydrolase
Deposited on 1999-07-30, released 2002-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PROTEIN (Ribonuclease A)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61823 (0-123)
      • mutation (44)
    Domains in SCOPe 2.07: d1c8wa_
  • Heterogens: ACT, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c8wA (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvngfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv