PDB entry 1c8u

View 1c8u on RCSB PDB site
Description: crystal structure of the e.coli thioesterase II, a homologue of the human nef-binding enzyme
Class: hydrolase
Keywords: internal repeats, hydrolase
Deposited on 1999-07-29, released 2000-07-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.218
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-coa thioesterase II
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1c8ua1, d1c8ua2
  • Chain 'B':
    Compound: acyl-coa thioesterase II
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1c8ub1, d1c8ub2
  • Heterogens: LDA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c8uA (A:)
    sqalknlltllnlekieeglfrgqsedlglrqvfggqvvgqalyaaketvpeerlvhsfh
    syflrpgdskkpiiydvetlrdgnsfsarrvaaiqngkpifymtasfqapeagfehqktm
    psapapdglpsetqiaqslahllppvlkdkficdrplevrpvefhnplkghvaephrqvw
    irangsvpddlrvhqyllgyasdlnflpvalqphgigflepgiqiatidhsmwfhrpfnl
    newllysvestsassargfvrgefytqdgvlvastvqegvmrnhn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c8uB (B:)
    sqalknlltllnlekieeglfrgqsedlglrqvfggqvvgqalyaaketvpeerlvhsfh
    syflrpgdskkpiiydvetlrdgnsfsarrvaaiqngkpifymtasfqapeagfehqktm
    psapapdglpsetqiaqslahllppvlkdkficdrplevrpvefhnplkghvaephrqvw
    irangsvpddlrvhqyllgyasdlnflpvalqphgigflepgiqiatidhsmwfhrpfnl
    newllysvestsassargfvrgefytqdgvlvastvqegvmrnhn