PDB entry 1c8t

View 1c8t on RCSB PDB site
Description: human stromelysin-1 (e202q) catalytic domain complexed with ro-26-2812
Class: hydrolase/hydrolase inhibitor
Keywords: protein-inhibitor complex, mutant protein, hydrolase/hydrolase inhibitor complex
Deposited on 1999-07-29, released 2000-07-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.22
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: stromelysin-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08254 (0-166)
      • engineered (116)
      • conflict (166)
    Domains in SCOPe 2.08: d1c8ta_
  • Chain 'B':
    Compound: stromelysin-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08254 (0-166)
      • engineered (116)
      • conflict (166)
    Domains in SCOPe 2.08: d1c8tb_
  • Heterogens: ZN, CA, TR1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c8tA (A:)
fpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadimis
favrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahqigh
slglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdp

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c8tB (B:)
fpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadimis
favrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahqigh
slglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdp