PDB entry 1c8s

View 1c8s on RCSB PDB site
Description: bacteriorhodopsin d96n late m state intermediate
Class: ion transport
Keywords: ion pump, membrane protein, retinal protein, lipids, photoreceptor, haloarchaea, d96n m intermediate, ion transport, merohedral twinning
Deposited on 1999-07-29, released 1999-10-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.173
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: bacteriorhodopsin ("m" state intermediate)
  Species: Halobacterium salinarum [TaxId:2242]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02945 (0-195)
    • engineered (91)
  Domains in SCOPe 2.08: d1c8sa_
• Heterogens: LI1, SQU, RET, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c8sA (A:)
  tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
  gltmvpfggeqnpiywaryadwlfttpllllnlallvdadqgtilalvgadgimigtglv
  galtkvysyrfvwwaistaamlyilyvlfnvtvvlwsaypvvwligsegagivplnietl
  lfmvldvsakvgfgli