PDB entry 1c8r

View 1c8r on RCSB PDB site
Description: bacteriorhodopsin d96n br state at 2.0 a resolution
Class: proton transport
Keywords: ion pump, membrane protein, retinal protein, lipids, photoreceptor, haloarchaea, d96n br state, ion transport, merohedral twinning, proton transport
Deposited on 1999-07-29, released 1999-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.127
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (bacteriorhodopsin)
    Species: Halobacterium salinarum [TaxId:2242]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02945
      • engineered (95)
    Domains in SCOPe 2.07: d1c8ra_
  • Heterogens: LI1, SQU, RET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c8rA (A:)
    qaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsm
    llgygltmvpfggeqnpiywaryadwlfttpllllnlallvdadqgtilalvgadgimig
    tglvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvv
    lwsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeaeapepsa
    gdgaaatsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c8rA (A:)
    tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
    gltmvpfggeqnpiywaryadwlfttpllllnlallvdadqgtilalvgadgimigtglv
    galtkvysyrfvwwaistaamlyilyvlffgfsmrpevastfkvlrnvtvvlwsaypvvw
    ligsegagivplnietllfmvldvsakvgfglillrsraifg