PDB entry 1c8p

View 1c8p on RCSB PDB site
Description: nmr structure of the ligand binding domain of the common beta-chain in the gm-csf, il-3 and il-5 receptors
Deposited on 1999-10-05, released 2000-06-15
The last revision prior to the SCOP 1.65 freeze date was dated 2000-06-21, with a file datestamp of 2000-06-21.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1c8pa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c8pA (A:)
    miqmappslnvtkdgdsyslrwetmkmryehidhtfeiqyrkdtatwkdsktetlqnahs
    malpalepstrywarvrvrtsrtgyngiwsewsearswdtes