PDB entry 1c8p

View 1c8p on RCSB PDB site
Description: nmr structure of the ligand binding domain of the common beta-chain in the gm-csf, il-3 and il-5 receptors
Deposited on 1999-10-05, released 2000-06-15
The last revision prior to the SCOP 1.57 freeze date was dated 2000-06-21, with a file datestamp of 2000-06-21.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1c8pa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c8pA (A:)
  miqmappslnvtkdgdsyslrwetmkmryehidhtfeiqyrkdtatwkdsktetlqnahs
  malpalepstrywarvrvrtsrtgyngiwsewsearswdtes