PDB entry 1c8o

View 1c8o on RCSB PDB site
Description: 2.9 a structure of cleaved viral serpin crma
Class: Viral protein
Keywords: SERPIN FOLD, Viral protein
Deposited on 2000-06-01, released 2000-09-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.223
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ice inhibitor
    Species: Cowpox virus [TaxId:10243]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07385 (0-299)
      • engineered (92)
      • engineered (101)
      • engineered (123)
      • engineered (222)
      • engineered (268)
      • engineered (297)
    Domains in SCOPe 2.08: d1c8o.1
  • Chain 'B':
    Compound: ice inhibitor
    Species: Cowpox virus [TaxId:10243]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07385 (Start-40)
      • engineered (12)
      • engineered (35)
    Domains in SCOPe 2.08: d1c8o.1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c8oA (A:)
mdifreiassmkgenvfisppsissvltilyygangstaeqlskyvekeadknkddisfk
smnkvygrysavfkdsflrkigdnfqtvdftdsrtvdainksvdiftegkinplldepls
pdtsllaisavyfkakwlmpfekeftsdypfyvsptemvdvsmmsmygeafnhasvkesf
gnfsiielpyvgdtsmvvilpdnidglesieqnltdtnfkkwsdsmdamfidvhipkfkv
tgsynlvdalvklgltevfgstgdysnmsnsdvsvdamihktyidvneeyteaaaatsal

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1c8oB (B:)
vadsastvtnefsadhpfiyvirhvdgkilfvgrysspttn

    Sequence, based on observed residues (ATOM records): (download) 
    >1c8oB (B:)
nefsadhpfiyvirhvdgkilfvgrysspttn