PDB entry 1c8l

View 1c8l on RCSB PDB site
Description: synergistic inhibition of glycogen phosphorylase a by a potential antidiabetic drug and caffeine
Class: transferase
Keywords: glycogen metabolism, diabetes, phosphorylase a, synergistic inhibition, allosteric site, inhibitor site, transferase
Deposited on 2000-05-16, released 2000-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (glycogen phosphorylase)
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00489
      • modified residue (13)
    Domains in SCOPe 2.07: d1c8la_
  • Heterogens: PLP, BIN, CFF, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c8lA (A:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c8lA (A:)
    sdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlv
    grwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeelee
    ieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlr
    ygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlw
    sakapnggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfks
    snfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpea
    lerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmah
    lciagshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeii
    aerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslf
    dvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiikli
    taigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfml
    ngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiie
    qlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvir
    niatsgkfssdrtiaqyareiwgvepsrqrlp