PDB entry 1c8i

View 1c8i on RCSB PDB site
Description: binding mode of hydroxylamine to arthromyces ramosus peroxidase
Deposited on 2000-05-08, released 2001-01-17
The last revision prior to the SCOP 1.59 freeze date was dated 2001-01-17, with a file datestamp of 2001-01-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.162
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1c8ia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c8iA (A:)
    svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
    gqfggggadgsiiahsnielafpanggltdtiealravginhgvsfgdliqfatavgmsn
    cpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
    qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
    lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
    ipggltvddievscpsepfpeiatasgplpslapap