PDB entry 1c8e

View 1c8e on RCSB PDB site
Description: feline panleukopenia virus empty capsid structure
Class: virus
Keywords: Beta Barrel, Viral Capsid, Icosahedral Symmetry, Icosahedral virus, Virus
Deposited on 2000-05-05, released 2000-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: feline panleukopenia virus capsid
    Species: Feline parvovirus [TaxId:10785]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P90438 (0-547)
      • conflict (67)
      • conflict (447)
      • conflict (472)
    Domains in SCOPe 2.07: d1c8ea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c8eA (A:)
    gvgistgtfnnqtefkflengwveitanssrlvhlnmpesenykrvvvnnmdktavkgnm
    alddihveivtpwslvdanawgvwfnpgdwqlivntmselhlvsfeqeifnvvlktvses
    atqpptkvynndltaslmvaldsnntmpftpaamrsetlgfypwkptiptpwryyfqwdr
    tlipshtgtsgtptnvyhgtdpddvqfytiensvpvhllrtgdefatgtfffdckpcrlt
    htwqtnralglppflnslpqsegatnfgdigvqqdkrrgvtqmgntdyiteatimrpaev
    gysapyysfeastqgpfktpiaagrggaqtdenqaadgdpryafgrqhgqkttttgetpe
    rftyiahqdtgrypegdwiqninfnlpvtndnvllptdpiggktginytnifntygplta
    lnnvppvypngqiwdkefdtdlkprlhinapfvcqnncpgqlfvkvapnltnqydpdasa
    nmsrivtysdfwwkgklvfkaklrashtwnpiqqmsinvdnqfnyvpnnigamkivyeks
    qlaprkly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c8eA (A:)
    gvgistgtfnnqtefkflengwveitanssrlvhlnmpesenykrvvvnnmdktavkgnm
    alddihveivtpwslvdanawgvwfnpgdwqlivntmselhlvsfeqeifnvvlktvses
    atqpptkvynndltaslmvaldsnntmpftpaamrsetlgfypwkptiptpwryyfqwdr
    tlipshtgtsgtptnvyhgtdpddvqfytiensvpvhllrtgdefatgtfffdckpcrlt
    htwqtnralglppflnslpqsegatnfgdigvqqdkrrgvtqmgntdyiteatimrpaev
    gysapyysfeastqgpfktpiaagdpryafgrqhgqkttttgetperftyiahqdtgryp
    egdwiqninfnlpvtndnvllptdpiggktginytnifntygpltalnnvppvypngqiw
    dkefdtdlkprlhinapfvcqnncpgqlfvkvapnltnqydpdasanmsrivtysdfwwk
    gklvfkaklrashtwnpiqqmsinvdnqfnyvpnnigamkivyeksqlaprkly