PDB entry 1c8d

View 1c8d on RCSB PDB site
Description: canine panleukopenia virus empty capsid structure
Class: virus
Keywords: Capsid, canine parvovirus, strain D, empty capsid, A300D, Icosahedral virus, Virus
Deposited on 2000-05-05, released 2000-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: canine parvovirus capsid
    Species: Canine parvovirus [TaxId:10788]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c8da_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c8dA (A:)
    msdgavqpdggqpavrneratgsgngsgggggggsggvgistgtfnnqtefkflengwvy
    itanssrlvhlnmpesenyrrvvvnnmdktavngnmalddihaeivtpwslvdanawgvw
    fnpgdwqlivntmselhlvsfeqeifnvvlktvsesatqpptkvynndltaslmvaldsn
    ntmpftpaamrsetlgfypwkptiptpwryyfqwdrtlipshtgtsgtptniyhgtdpdd
    vqfytiensvpvhllrtgdefatgtfffdckpcrlthtwqtnralglppflnslpqsegd
    tnfgdigvqqdkrrgvtqmgntnyiteatimrpaevgysapyysfeastqgpfktpiaag
    rggaqtdenqaadgnpryafgrqhgqkttttgetperftyiahqdtgrypegdwiqninf
    nlpvtndnvllptdpiggktginytnifntygpltalnnvppvypngqiwdkefdtdlkp
    rlhvnapfvcqnncpgqlfvkvapnltnqydpdasanmsrivtysdfwwkgklvfkaklr
    ashtwnpiqqmsinvdnqfnyvpsniggmkivyeksqlaprkly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c8dA (A:)
    gvgistgtfnnqtefkflengwvyitanssrlvhlnmpesenyrrvvvnnmdktavngnm
    alddihaeivtpwslvdanawgvwfnpgdwqlivntmselhlvsfeqeifnvvlktvses
    atqpptkvynndltaslmvaldsnntmpftpaamrsetlgfypwkptiptpwryyfqwdr
    tlipshtgtsgtptniyhgtdpddvqfytiensvpvhllrtgdefatgtfffdckpcrlt
    htwqtnralglppflnslpqsegdtnfgdigvqqdkrrgvtqmgntnyiteatimrpaev
    gysapyysfeastqgpfktpiaagrggaqtdenqaadgnpryafgrqhgqkttttgetpe
    rftyiahqdtgrypegdwiqninfnlpvtndnvllptdpiggktginytnifntygplta
    lnnvppvypngqiwdkefdtdlkprlhvnapfvcqnncpgqlfvkvapnltnqydpdasa
    nmsrivtysdfwwkgklvfkaklrashtwnpiqqmsinvdnqfnyvpsniggmkivyeks
    qlaprkly