PDB entry 1c8c

View 1c8c on RCSB PDB site
Description: crystal structures of the chromosomal proteins sso7d/sac7d bound to dna containing t-g mismatched base pairs
Deposited on 2000-05-04, released 2001-05-04
The last revision prior to the SCOP 1.71 freeze date was dated 2001-05-04, with a file datestamp of 2001-05-04.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.229
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1c8ca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c8cA (A:)
    matvkfkykgeekqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmla
    kqkk