PDB entry 1c8c

View 1c8c on RCSB PDB site
Description: crystal structures of the chromosomal proteins sso7d/sac7d bound to DNA containing t-g mismatched base pairs
Class: DNA binding protein/DNA
Keywords: DNA binding protein, protein-DNA interaction, protein stability, hyperthermophile, achaeabacteria, electrostatics, molecular modeling, t-g mismatch, DNA binding protein-DNA complex
Deposited on 2000-05-04, released 2001-05-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding protein 7a
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1c8ca_
  • Chain 'B':
    Compound: 5'-d(*gp*tp*gp*ap*tp*cp*gp*c)-3'
  • Chain 'C':
    Compound: 5'-d(*gp*tp*gp*ap*tp*cp*gp*c)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c8cA (A:)
    matvkfkykgeekqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmla
    kqkk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.