PDB entry 1c8c

View 1c8c on RCSB PDB site
Description: crystal structures of the chromosomal proteins sso7d/sac7d bound to DNA containing t-g mismatched base pairs
Class: DNA binding protein/DNA
Keywords: DNA binding protein, protein-DNA interaction, protein stability, hyperthermophile, achaeabacteria, electrostatics, molecular modeling, t-g mismatch, DNA binding protein-DNA complex
Deposited on 2000-05-04, released 2001-05-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA-binding protein 7a
  Species: Sulfolobus solfataricus [TaxId:2287]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39476 (0-63)
  Domains in SCOPe 2.08: d1c8ca_
• Chain 'B':
  Compound: 5'-d(*gp*tp*gp*ap*tp*cp*gp*c)-3'
  
• Chain 'C':
  Compound: 5'-d(*gp*tp*gp*ap*tp*cp*gp*c)-3'
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c8cA (A:)
  matvkfkykgeekqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmla
  kqkk
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.