PDB entry 1c8b

View 1c8b on RCSB PDB site
Description: crystal structure of a novel germination protease from spores of bacillus megaterium: structural rearrangements and zymogen activation
Class: hydrolase
Keywords: novel fold, hydrolase
Deposited on 2000-05-03, released 2001-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.308
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spore protease
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c8ba_
  • Chain 'B':
    Compound: spore protease
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c8bb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c8bA (A:)
    mekeldlsqysvrtdlaveakdialenqpkpnnqseikgvivkekeeqgvkismveitee
    gaeaigkkkgryvtlesvgireqdtekqeeameevfakelnffikslnipddasclvvgl
    gnlsvtpdalgpkavdnllitrhlfelqpesvqdgfrpvsaivpgvmgmtgietsdiifg
    vvkkvnpdfiiaidalaarsiervnatiqisdsgihpgsgvgnkrkeisyetlgipviai
    giptvvdavsitsdtidfilkhfgremkeqgkpsksllpsgmtfgekkklteddlpneeq
    rqtylgmigtlpdeekrrlihevlaplghnlmvtpkevdmfiedmanvvagglnaalhhe
    vdqenfgayth
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c8bA (A:)
    mekeldlsqysvrtdlaveakdialenqpkvivkekeeqgvkismveiteegaeaigkkk
    gryvtlesvgireqdtekqeeameevfakelnffikslnipddasclvvglgnlsvtpda
    lgpkavdnllitrhlfelqpesvqdgfrpvsaivpgvmgmtgietsdiifgvvkkvnpdf
    iiaidalaarsiervnatiqisdsgihpgsgvgnkrkeisyetlptvvdavsitsdtidf
    ilkhfgremkeqglgmigtlpdeekrrlihevlaplghnlmvtpkevdmfiedmanvvag
    glnaalhhevdqenfgayth
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c8bB (B:)
    mekeldlsqysvrtdlaveakdialenqpkpnnqseikgvivkekeeqgvkismveitee
    gaeaigkkkgryvtlesvgireqdtekqeeameevfakelnffikslnipddasclvvgl
    gnlsvtpdalgpkavdnllitrhlfelqpesvqdgfrpvsaivpgvmgmtgietsdiifg
    vvkkvnpdfiiaidalaarsiervnatiqisdsgihpgsgvgnkrkeisyetlgipviai
    giptvvdavsitsdtidfilkhfgremkeqgkpsksllpsgmtfgekkklteddlpneeq
    rqtylgmigtlpdeekrrlihevlaplghnlmvtpkevdmfiedmanvvagglnaalhhe
    vdqenfgayth
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c8bB (B:)
    mekeldlsqysvrtdlaveakdialenqpkvivkekeeqgvkismveiteegaeaigkkk
    gryvtlesvgireqdtekqeeameevfakelnffikslnipddasclvvglgnlsvtpda
    lgpkavdnllitrhlfelqpesvqdgfrpvsaivpgvmgmtgietsdiifgvvkkvnpdf
    iiaidalaarsiervnatiqisdsgihpgsgvgnkrkeisyetlptvvdavsitsdtidf
    ilkhfgremkeqglgmigtlpdeekrrlihevlaplghnlmvtpkevdmfiedmanvvag
    glnaalhhevdqenfgayth