PDB entry 1c8a

View 1c8a on RCSB PDB site
Description: nmr structure of intramolecular dimer antifreeze protein rd3, 40 sa structures
Class: antifreeze protein
Keywords: antifreeze, antifreeze protein, thermal hysteresis protein, ice binding protein
Deposited on 2000-05-04, released 2001-02-28
The last revision prior to the SCOP 1.75 freeze date was dated 2001-02-28, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (antifreeze protein type III)
    Species: Pachycara brachycephalum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1c8aa1, d1c8aa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c8aA (A:)
nkasvvanqlipintaltlimmkaevvtpmgipaeeipnlvgmqvnravplgttlmpdmv
knyedgttspglksvvanqlipintaltlvmmkaeevspkgipseeisklvgmqvnravy
ldqtlmpdmvknye