PDB entry 1c8a

View 1c8a on RCSB PDB site
Description: nmr structure of intramolecular dimer antifreeze protein rd3, 40 sa structures
Class: antifreeze protein
Keywords: antifreeze, antifreeze protein, thermal hysteresis protein, ice binding protein
Deposited on 2000-05-04, released 2001-02-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (antifreeze protein type III)
    Species: Pachycara brachycephalum, synthetic [TaxId:36221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1c8aa1, d1c8aa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c8aA (A:)
    nkasvvanqlipintaltlimmkaevvtpmgipaeeipnlvgmqvnravplgttlmpdmv
    knyedgttspglksvvanqlipintaltlvmmkaeevspkgipseeisklvgmqvnravy
    ldqtlmpdmvknye