PDB entry 1c89

View 1c89 on RCSB PDB site
Description: nmr structure of intramolecular dimer antifreeze protein rd3, 40 sa structures
Class: antifreeze protein
Keywords: antifreeze, thermal hysteresis protein, ice binding protein
Deposited on 2000-05-04, released 2001-02-28
The last revision prior to the SCOP 1.75 freeze date was dated 2001-02-28, with a file datestamp of 2007-06-04.
Experiment type: NMR40
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: antifreeze protein type III
  Species: Pachycara brachycephalum
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35753 (0-133)
  Domains in SCOP 1.75: d1c89a1, d1c89a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c89A (A:)
  nkasvvanqlipintaltlimmkaevvtpmgipaeeipnlvgmqvnravplgttlmpdmv
  knyedgttspglksvvanqlipintaltlvmmkaeevspkgipseeisklvgmqvnravy
  ldqtlmpdmvknye