PDB entry 1c89

View 1c89 on RCSB PDB site
Description: nmr structure of intramolecular dimer antifreeze protein rd3, 40 sa structures
Class: antifreeze protein
Keywords: antifreeze, thermal hysteresis protein, ice binding protein
Deposited on 2000-05-04, released 2001-02-28
The last revision prior to the SCOP 1.73 freeze date was dated 2001-02-28, with a file datestamp of 2007-06-04.
Experiment type: NMR40
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antifreeze protein type III
    Species: Pachycara brachycephalum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1c89a1, d1c89a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c89A (A:)
    nkasvvanqlipintaltlimmkaevvtpmgipaeeipnlvgmqvnravplgttlmpdmv
    knyedgttspglksvvanqlipintaltlvmmkaeevspkgipseeisklvgmqvnravy
    ldqtlmpdmvknye