PDB entry 1c89

View 1c89 on RCSB PDB site
Description: nmr structure of intramolecular dimer antifreeze protein rd3, 40 sa structures
Deposited on 2000-05-04, released 2001-02-28
The last revision prior to the SCOP 1.69 freeze date was dated 2001-02-28, with a file datestamp of 2001-02-28.
Experiment type: NMR40
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c89A (A:)
nkasvvanqlipintaltlimmkaevvtpmgipaeeipnlvgmqvnravplgttlmpdmv
knyedgttspglksvvanqlipintaltlvmmkaeevspkgipseeisklvgmqvnravy
ldqtlmpdmvknye