PDB entry 1c82

View 1c82 on RCSB PDB site
Description:
Deposited on 2000-04-05, released 2001-04-05
The last revision prior to the SCOP 1.59 freeze date was dated 2001-04-05, with a file datestamp of 2001-04-05.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.215
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c82A (A:)
    kdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssissqadriylwekfs
    nyktsanltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksivgn
    wwdyeigtprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpfkalggnl
    vdmgrvkviagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytgaygn
    vlidglsqllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisranse
    ghvaavevlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmqsll
    sdagvasvprtsylsafnkmdktamynaekgfgfglslfssrtlnyehmnkenkrgwyts
    dgmfylyngdlshysdgywptvnpykmpgttetdakradsdtgkvlpsafvgtsklddan
    atatmdftnwnqtltahkswfmlkdkiaflgsniqntstdtaattidqrklessnpykvy
    vndkeaslteqekdypetqsvflessdskknigyfffkkssismskalqkgawkdinegq
    sdkevenefltisqahkqngdsygymlipnvdratfnqmikelessliennetlqsvyda
    kqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayynpetqesapdqevfkk