PDB entry 1c82

View 1c82 on RCSB PDB site
Description: mechanism of hyaluronan binding and degradation: structure of streptococcus pneumoniae hyaluronate lyase in complex with hyaluronic acid disaccharide at 1.7 a resolution
Class: lyase
Keywords: protein-carbohydrate complex, lyase
Deposited on 2000-04-05, released 2001-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.215
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hyaluronate lyase
    Species: Streptococcus pneumoniae [TaxId:1313]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q54873
      • see remark 999 (563)
    Domains in SCOPe 2.07: d1c82a1, d1c82a2, d1c82a3
  • Heterogens: CAC, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c82A (A:)
    asvkdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssissqadriylwe
    kfsnyktsanltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksi
    vgnwwdyeigtprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpfkalg
    gnlvdmgrvkviagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytga
    ygnvlidglsqllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisra
    nseghvaavevlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmq
    sllsdagvasvprtsylsafnkmdktamynaekgfgfglslfssrtlnyehmnkenkrgw
    ytsdgmfylyngdlshysdgywptvnpykmpgttetdakradsdtgkvlpsafvgtskld
    danatatmdftnwnqtltahkswfmlkdkiaflgsniqntstdtaattidqrklessnpy
    kvyvndkeaslteqekdypetqsvflessdskknigyfffkkssismskalqkgawkdin
    egqsdkevenefltisqahkqngdsygymlipnvdratfnqmikelessliennetlqsv
    ydakqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayynpetqesapdqevf
    kkleqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c82A (A:)
    kdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssissqadriylwekfs
    nyktsanltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksivgn
    wwdyeigtprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpfkalggnl
    vdmgrvkviagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytgaygn
    vlidglsqllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisranse
    ghvaavevlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmqsll
    sdagvasvprtsylsafnkmdktamynaekgfgfglslfssrtlnyehmnkenkrgwyts
    dgmfylyngdlshysdgywptvnpykmpgttetdakradsdtgkvlpsafvgtsklddan
    atatmdftnwnqtltahkswfmlkdkiaflgsniqntstdtaattidqrklessnpykvy
    vndkeaslteqekdypetqsvflessdskknigyfffkkssismskalqkgawkdinegq
    sdkevenefltisqahkqngdsygymlipnvdratfnqmikelessliennetlqsvyda
    kqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayynpetqesapdqevfkk