PDB entry 1c7y

View 1c7y on RCSB PDB site
Description: e.coli ruva-holliday junction complex
Deposited on 2000-04-03, released 2000-07-21
The last revision prior to the SCOP 1.55 freeze date was dated 2000-07-21, with a file datestamp of 2000-07-21.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.249
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c7yA (A:)
    migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
    ygfnnkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkkt
    aerlivemkdrfkglhgdlftpaadlvltspaspatddaeqeavaalvalgykpqeasrm
    vskiarpdassetlirealraal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c7yA (A:)
    migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
    ygfnnkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkkt
    aerlivemkdrfkglhgdlftpaadlvltsatddaeqeavaalvalgykpqeasrmvski
    arpdassetlirealraal