PDB entry 1c7y

View 1c7y on RCSB PDB site
Description: e.coli ruva-holliday junction complex
Class: recombination/DNA
Keywords: helix-hairpin-helix, protein-DNA complex, homologous recombination, Holliday junction, RECOMBINATION/DNA COMPLEX
Deposited on 2000-04-03, released 2000-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.249
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: holliday junction DNA helicase ruva
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c7ya1, d1c7ya2, d1c7ya3
  • Chain 'B':
    Compound: DNA (5'-d(p*dap*dap*dgp*dtp*dtp*dgp*dgp*dgp*dap*dtp*dtp*dgp*dt)-3')
  • Chain 'C':
    Compound: DNA (5'-d(p*dcp*dtp*dgp*dtp*dgp*dtp*dgp*dtp*dap*dap*dgp*dc)-3')
  • Chain 'D':
    Compound: DNA (5'-d(p*dgp*dcp*dtp*dtp*dap*dcp*dap*dcp*dap*dcp*dap*dgp*da)-3')
  • Chain 'E':
    Compound: DNA (5'-d(p*dgp*dgp*dtp*dtp*dap*dgp*dgp*dgp*dtp*dgp*dap*da)-3')
  • Chain 'F':
    Compound: DNA (5'-d(p*dtp*dtp*dcp*dap*dcp*dcp*dcp*dtp*dap*dap*dcp*dcp*da)-3')
  • Chain 'G':
    Compound: DNA (5'-d(p*dgp*dap*dcp*dap*dcp*dap*dcp*dap*dtp*dtp*dcp*dg)-3')
  • Chain 'H':
    Compound: DNA (5'-d(p*dcp*dgp*dap*dap*dtp*dgp*dtp*dgp*dtp*dgp*dtp*dcp*dt)-3')
  • Chain 'I':
    Compound: DNA (5'-d(p*dcp*dap*dap*dtp*dcp*dcp*dcp*dap*dap*dcp*dtp*dt)-3')

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c7yA (A:)
    migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
    ygfnnkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkkt
    aerlivemkdrfkglhgdlftpaadlvltspaspatddaeqeavaalvalgykpqeasrm
    vskiarpdassetlirealraal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c7yA (A:)
    migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
    ygfnnkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkkt
    aerlivemkdrfkglhgdlftpaadlvltsatddaeqeavaalvalgykpqeasrmvski
    arpdassetlirealraal
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.