PDB entry 1c7w

View 1c7w on RCSB PDB site
Description: nmr solution structure of the calcium-bound c-terminal domain (w81- s161) of calcium vector protein from amphioxus
Deposited on 2000-03-27, released 2000-04-12
The last revision prior to the SCOP 1.55 freeze date was dated 2000-09-27, with a file datestamp of 2000-09-27.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1c7wa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7wA (A:)
    eeeilrafkvfdangdgvidfdefkfimqkvgeepltdaeveeamkeadedgngvidipe
    fmdlikks