PDB entry 1c7v

View 1c7v on RCSB PDB site
Description: nmr solution structure of the calcium-bound c-terminal domain (w81-s161) of calcium vector protein from amphioxus
Class: metal binding protein
Keywords: ef-hand family, calcium binding protein, nmr, metal binding protein
Deposited on 2000-03-27, released 2000-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calcium vector protein
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c7va_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c7vA (A:)
    wvrqddeeeilrafkvfdangdgvidfdefkfimqkvgeepltdaeveeamkeadedgng
    vidipefmdlikksknalkes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c7vA (A:)
    eeeilrafkvfdangdgvidfdefkfimqkvgeepltdaeveeamkeadedgngvidipe
    fmdlikks