PDB entry 1c7u

View 1c7u on RCSB PDB site
Description: Complex of the DNA binding core domain of the transcription factor MEF2A with a 20mer oligonucleotide
Class: transcription/DNA
Keywords: DNA binding protein, transcription factor, mads-box, sam domain, transcription/DNA complex
Deposited on 2000-03-17, released 2000-03-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myocyte-specific enhancer factor 2a, c4 form
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02078
      • conflict (37)
      • conflict (39)
    Domains in SCOPe 2.08: d1c7ua_
  • Chain 'B':
    Compound: myocyte-specific enhancer factor 2a, c4 form
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02078 (0-End)
      • conflict (37)
      • conflict (39)
    Domains in SCOPe 2.08: d1c7ub_
  • Chain 'C':
    Compound: 5'-d(*cp*tp*cp*gp*gp*cp*tp*ap*tp*tp*ap*ap*tp*ap*gp*cp*cp*gp*ap*g)-3'
  • Chain 'D':
    Compound: 5'-d(*cp*tp*cp*gp*gp*cp*tp*ap*tp*tp*ap*ap*tp*ap*gp*cp*cp*gp*ap*g)-3'

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c7uA (A:)
    grkkiqitrimdernrqvtftkrkfglmkkayelsvladaeialiifnssnklfqyastd
    mdkvllkyteynephesrtnsdive
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c7uA (A:)
    grkkiqitrimdernrqvtftkrkfglmkkayelsvladaeialiifnssnklfqyastd
    mdkvllkyteynep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c7uB (B:)
    grkkiqitrimdernrqvtftkrkfglmkkayelsvladaeialiifnssnklfqyastd
    mdkvllkyteynephesrtnsdive
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c7uB (B:)
    grkkiqitrimdernrqvtftkrkfglmkkayelsvladaeialiifnssnklfqyastd
    mdkvllkyteynep
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.