PDB entry 1c7t

View 1c7t on RCSB PDB site
Description: beta-n-acetylhexosaminidase mutant e540d complexed with di-n acetyl-d-glucosamine (chitobiase)
Class: hydrolase
Keywords: glycosyl hydrolase, beta-n-acetylhexosaminidase, chitinolysin, a/b(tim)-barrel, site directed mutagenesis, proton donor, x-ray diffraction, co-crystal structure
Deposited on 2000-03-17, released 2000-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.204
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-n-acetylhexosaminidase
    Species: Serratia marcescens [TaxId:615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q54468 (0-857)
      • conflict (456)
      • engineered (512)
      • conflict (800)
    Domains in SCOPe 2.07: d1c7ta1, d1c7ta2, d1c7ta3, d1c7ta4
  • Heterogens: CBS, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7tA (A:)
    dqqlvdqlsqlklnvkmldnragengvdcaalgadwascnrvlftlsndgqaidgkdwvi
    yfhsprqtlrvdndqfkiahltgdlykleptakfsgfpagkaveipvvaeywqlfrndfl
    prwyatsgdakpkmlantdtenldqfvapftgdqwkrtkddknilmtpasrfvsnadlqt
    lpagalrgkivptpmqvkvhaqdadlrkgvaldlstlvkpaadvvsqrfallgvpvqtng
    ypiktdiqpgkfkgamavsgayelkigkkeaqvigfdqagvfyglqsilslvpsdgsgki
    atldasdaprfpyrgifldvarnfhkkdavlrlldqmaayklnkfhfhlsddegwrieip
    glpeltevggqrchdlsettcllpqygqgpdvyggffsrqdyidiikyaqarqievipei
    dmpaharaavvsmearykklhaagkeqeanefrlvdqtdtsnttsvqffnrqsylnpcld
    ssqrfvdkvigeiaqmhkeagqpiktwhfggddaknirlgagytdkakpepgkgiidqsn
    edkpwaksqvcqtmikegkvadmehlpsyfgqevsklvkahgidrmqawqdglkdaessk
    afatsrvgvnfwdtlywggfdsvndwankgyevvvsnpdyvymdfpyevnpdergyywgt
    rfsderkvfsfapdnmpqnaetsvdrdgnhfnaksdkpwpgayglsaqlwsetqrtdpqm
    eymifpralsvaerswhragweqdyragreykggethfvdtqalekdwlrfanilgqrel
    akldkggvayrlpvpgarvaggkleanialpglgieystdggkqwqrydakakpavsgev
    qvrsvspdgkrysraekv