PDB entry 1c7s

View 1c7s on RCSB PDB site
Description: beta-n-acetylhexosaminidase mutant d539a complexed with di-n-acetyl- beta-d-glucosamine (chitobiase)
Deposited on 2000-03-14, released 2000-09-20
The last revision prior to the SCOP 1.55 freeze date was dated 2000-09-20, with a file datestamp of 2000-09-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.183
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7sA (A:)
    dqqlvdqlsqlklnvkmldnragengvdcaalgadwascnrvlftlsndgqaidgkdwvi
    yfhsprqtlrvdndqfkiahltgdlykleptakfsgfpagkaveipvvaeywqlfrndfl
    prwyatsgdakpkmlantdtenldqfvapftgdqwkrtkddknilmtpasrfvsnadlqt
    lpagalrgkivptpmqvkvhaqdadlrkgvaldlstlvkpaadvvsqrfallgvpvqtng
    ypiktdiqpgkfkgamavsgayelkigkkeaqvigfdqagvfyglqsilslvpsdgsgki
    atldasdaprfpyrgifldvarnfhkkdavlrlldqmaayklnkfhfhlsddegwrieip
    glpeltevggqrchdlsettcllpqygqgpdvyggffsrqdyidiikyaqarqievipei
    dmpaharaavvsmearykklhaagkeqeanefrlvdqtdtsnttsvqffnrqsylnpcld
    ssqrfvdkvigeiaqmhkeagqpiktwhfggaeaknirlgagytdkakpepgkgiidqsn
    edkpwaksqvcqtmikegkvadmehlpsyfgqevsklvkahgidrmqawqdglkdaessk
    afatsrvgvnfwdtlywggfdsvndwankgyevvvsnpdyvymdfpyevnpdergyywgt
    rfsderkvfsfapdnmpqnaetsvdrdgnhfnaksdkpwpgayglsaqlwsetqrtdpqm
    eymifpralsvaerswhragweqdyragreykggethfvdtqalekdwlrfanilgqrel
    akldkggvayrlpvpgarvaggkleanialpglgieystdggkqwqrydakakpavsgev
    qvrsvspdgkrysraekv