PDB entry 1c7r

View 1c7r on RCSB PDB site
Description: the crystal structure of phosphoglucose isomerase/autocrine motility factor/neuroleukin complexed with its carbohydrate phosphate inhibitors and its substrate recognition mechanism
Class: isomerase
Keywords: phosphoglucose isomerase/autocrine motility factor/ neuroleukin, isomerase
Deposited on 2000-03-02, released 2000-09-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.215
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglucose isomerase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c7ra_
  • Heterogens: PA5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c7rA (A:)
    maisfdysnalpfmqeneldylsefvkaahhmlherkgpgsdflgwvdwpirydknefsr
    ikqaaerirnhsdalvvigiggsylgaraaiealshtfhnqmndttqiyfagqnisstyi
    shlldvlegkdlsinvisksgtttepaiafrifrdymekkygkeearkriyvttdrtkga
    lkkladqegyetfvipdniggrysvltavgllpiavaglnidrmmegaasayhkynnpdl
    ltnesyqyaavrnilyrkgkaiellvnyepslhyvsewwkqlfgesegkdqkglfpasvd
    fttdlhsmgqyvqegrrnlietvlhvkkpqieltiqedpenidglnflagktldevnkka
    fqgtllahvdggvpnliveldemneytfgemvyffekacgisghllgvnpfdqpgveayk
    knmfallgkpgfedekaalmkrlsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c7rA (A:)
    aisfdysnalpfmqeneldylsefvkaahhmlherkgpgsdflgwvdwpirydknefsri
    kqaaerirnhsdalvvigiggsylgaraaiealstqiyfagqnisstyishlldvlegkd
    lsinvisksgtttepaiafrifrdymekkygkeearkriyvttdrtkgalkkladqegye
    tfvipdniggrysvltavgllpiavaglnidrmmegaasayhkynnpdlltnesyqyaav
    rnilyrkgkaiellvnyepslhyvsewwkqlfgesegkdqkglfpasvdfttdlhsmgqy
    vqegrrnlietvlhvkkpqieltiqedpenidglnflagktldevnkkafqgtllahvdg
    gvpnliveldemneytfgemvyffekacgisghllgvnpfdqpgveaykknmfallgkpg
    fedekaalmkrl